Recombinant Mouse Putative L-aspartate dehydrogenase(Aspdh)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9DCQ2
Gene Names Aspdh
Alternative Names Aspartate dehydrogenase domain-containing protein
Expression Region Full Length(1-287aa )
Molecular Weight 37.7 kDa
Protein Sequence MATSTLPQVPYKVGVVGYGRLGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPALQLQDLTALEERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALADQTTEQQLLEASKRWGHTVFVARGALWGSEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSSGPRTVLYEGPVRGLCPLAPRNSNTMAAAALAAPSLGFDRVIGVLVADLSLTDMHVVDVELLGPPGPSGRSFAVHTHRENPAQPGAVTGSATVTAFWHSLLGCCQLTSRPGIHLC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Aspdh
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE0MO872185

Recombinant Mouse Putative L-aspartate dehydrogenase(Aspdh)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Putative L-aspartate dehydrogenase(Aspdh)
Copyright © 2021-present Echo Biosystems. All rights reserved.