Recombinant Mouse Pulmonary surfactant-associated protein C(Sftpc)

Specification
Organism Mus musculus(Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-KSI-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P21841
Gene Names Sftpc
Alternative Names Pulmonary surfactant-associated proteolipid SPL(Val) (SP5) (SP-C) (Sftp2)
Expression Region Full Length of Mature Protein(24-58aa )
Molecular Weight 19.1 kDa
Protein Sequence FRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Sftpc
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE4MO21299

Recombinant Mouse Pulmonary surfactant-associated protein C(Sftpc)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Pulmonary surfactant-associated protein C(Sftpc)
Copyright © 2021-present Echo Biosystems. All rights reserved.