Specification
Organism | Mus musculus (Mouse) |
Expression Host | in vitro E.coli expression system |
Protein Tag | N-terminal 10xHis-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | Q99PA5 |
Gene Names | Nkg7 |
Alternative Names | (Natural killer cell protein 7) |
Expression Region | 1-165aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.960 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1074℃. |
Protein Length | Full Length |
Molecular Weight | 19.5 kDa |
Protein Sequence | MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPTSQETQVAGYIHVTQSFCILAVLWGLVSVSFLILSCIPALSAPGRGPLVSTVMAFSAALSILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYETL |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |