Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q04592 |
| Gene Names | Pcsk5 |
| Alternative Names | Proprotein convertase 5 Short name: PC5 Proprotein convertase 6 Short name: PC6 Subtilisin-like proprotein convertase 6 Short name: SPC6 Subtilisin/kexin-like protease PC5 |
| Expression Region | Partial(117-452aa ) |
| Molecular Weight | 38.7 kDa |
| Protein Sequence | DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein |
| Protein Families | Peptidase S8 family |
| Tissue Specificity | Pcsk5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
