Recombinant Mouse Prolactin receptor(Prlr),partial (Active)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal 10xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID Q08501
Uniprot Entry Name
Gene Names Prlr
Alternative Names (PRL-R)
Expression Region Partial (20-229aa)
Molecular Weight 27.3 kDa
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance This is a receptor for the anterior pituitary hormone prolactin.
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$241.00
In stock
SKU
EB-CMPMO18852

Recombinant Mouse Prolactin receptor(Prlr),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Prolactin receptor(Prlr),partial (Active)
Copyright © 2026-present Echo Bio. All rights reserved.