Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Tag Info | N-terminal hFc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P57774 |
| Gene Names | Npy |
| Alternative Names | Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY); C-flanking peptide of NPY(CPON)] |
| Expression Region | Partial(29-64aa ) |
| Molecular Weight | 30.9 kDa |
| Protein Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Npy |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |