Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Flag-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q810Q5 |
| Gene Names | Nmes1 |
| Alternative Names | Nmes1Normal mucosa of esophagus-specific gene 1 protein |
| Expression Region | Full Length(1-83aa ) |
| Molecular Weight | 12.6 kDa |
| Protein Sequence | MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | |
| Subcellular Location | Nucleus |
| Protein Families | Complex I NDUFA4 subunit family |
| Tissue Specificity | Nmes1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |