Specification
Organism | Mus musculus (Mouse) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q64669 |
Gene Names | Nqo1 |
Alternative Names | Azoreductase DT-diaphorase Short name: DTD Menadione reductase NAD(P)H:quinone oxidoreductase 1 Phylloquinone reductase Quinone reductase 1 Short name: QR1 |
Expression Region | Full Length of Mature Protein(2-274aa ) |
Molecular Weight | 32.8 kDa |
Protein Sequence | AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | NAD(P)H dehydrogenase (quinone) family |
Tissue Specificity | Nqo1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |