Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8R4B8 |
| Gene Names | Nlrp3 |
| Alternative Names | Cold autoinflammatory syndrome 1 protein homolog Cryopyrin Mast cell maturation-associated-inducible protein 1 PYRIN-containing APAF1-like protein 1 |
| Expression Region | Partial(1-153aa ) |
| Molecular Weight | 34.2 kDa |
| Protein Sequence | MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May function as an inducer of apoptosis. Interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling. Inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA (By similarity). Activates caspase-1 as part of the NALP3 inflammasome complex in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytosol, Inflammasome, Endoplasmic reticulum, Secreted, Nucleus |
| Protein Families | NLRP family |
| Tissue Specificity | Nlrp3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |