Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P27106 |
| Gene Names | Amh |
| Alternative Names | Anti-Muellerian hormone |
| Expression Region | Partial(450-552aa ) |
| Molecular Weight | 11.3 kDa |
| Protein Sequence | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | Amh |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |