Recombinant Mouse Methyltransferase-like protein 10(Mettl10)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info C-terminal 6xHis-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9D853
Gene Names Eef1akmt2
Alternative Names Methyltransferase-like protein 10;Protein-lysine N-methyltransferase Mettl10
Expression Region Full Length(1-244aa )
Molecular Weight 30.3 kDa
Protein Sequence MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Eef1akmt2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PY2MO880647

Recombinant Mouse Methyltransferase-like protein 10(Mettl10)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Methyltransferase-like protein 10(Mettl10)
Copyright © 2021-present Echo Biosystems. All rights reserved.