Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-KSI-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q4JK59 |
| Gene Names | Tet2 |
| Alternative Names | Protein Ayu17-449 (Kiaa1546) |
| Expression Region | Partial(1810-1912aa ) |
| Molecular Weight | 27.0 kDa |
| Protein Sequence | RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine into 5-hydroxymethylcytosine and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine, and conversion of 5fC to 5-carboxylcytosine. Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | TET family |
| Tissue Specificity | Tet2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |