Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q3UEK1 |
| Gene Names | Mbl2 |
| Alternative Names | (Mannose-binding protein C) |
| Expression Region | 19-244aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.12 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-104℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 29.9 kDa |
| Protein Sequence | ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD |
Background
| Research Areas | Immunology |
| Relevance | |
| Function | |
| Reference | "Characterization and quantification of mouse mannan-binding lectins (MBL-A and MBL-C) and study of acute phase responses." Liu H., Jensen L., Hansen S., Petersen S.V., Takahashi K., Ezekowitz A.B., Hansen F.D., Jensenius J.C., Thiel S. Scand J Immunol 53:489-497(2001) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |