Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Protein Tag | N-terminal 6xHis-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | Not test. |
Biological Activity | |
Uniprot ID | Q3UEK1 |
Gene Names | Mbl2 |
Alternative Names | (Mannose-binding protein C) |
Expression Region | 19-244aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.12 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-104℃. |
Protein Length | Full Length of Mature Protein |
Molecular Weight | 29.9 kDa |
Protein Sequence | ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD |
Background
Research Areas | Immunology |
Relevance | |
Function | |
Reference | "Characterization and quantification of mouse mannan-binding lectins (MBL-A and MBL-C) and study of acute phase responses." Liu H., Jensen L., Hansen S., Petersen S.V., Takahashi K., Ezekowitz A.B., Hansen F.D., Jensenius J.C., Thiel S. Scand J Immunol 53:489-497(2001) |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |