Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07141
Gene Names Csf1
Alternative Names Csf1; CsfmMacrophage colony-stimulating factor 1; CSF-1; MCSF) [Cleaved into: Processed macrophage colony-stimulating factor 1]
Expression Region Partial(33-262aa )
Molecular Weight 30 kDa
Protein Sequence KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hatopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and fale fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of mbrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Involvement in Disease A defect in Csf1 is the cause of osteopetrosis. Osteopetrotic mice (op/op) are severely deficient in mature macrophages and osteoclasts, display failed tooth eruption, and have a restricted capacity for bone remodeling.
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed macrophage colony-stimulating factor 1: Secreted, extracellular space
Protein Families
Tissue Specificity Csf1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE3MO6168

Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Macrophage colony-stimulating factor 1(Csf1),partial
Copyright © 2026-present Echo Bio. All rights reserved.