Specification
Organism | Mus musculus (Mouse) |
Expression Host | Mammalian cell |
Tag Info | N-terminal Flag-Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9JHF9 |
Gene Names | Ly96 |
Alternative Names | ESOP-1 Protein MD-2 |
Expression Region | Full Length of Mature Protein(19-160aa ) |
Molecular Weight | 20.9 kDa |
Protein Sequence | EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Binds bacterial lipopolysaccharide (LPS) (PubMed:22532668). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS (PubMed:10725698). |
Involvement in Disease | |
Subcellular Location | Secreted, extracellular space, Secreted |
Protein Families | |
Tissue Specificity | Ly96 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |