Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-sumostar-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0CW02
Gene Names Ly6c1
Alternative Names Ly6c1; Lymphocyte antigen 6C1; Ly-6C1
Expression Region Full Length of Mature Protein(27-109aa )
Molecular Weight 25.1 kDa
Protein Sequence LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
Tissue Specificity Ly6c1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYOa43178259

Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)
Copyright © 2021-present Echo Biosystems. All rights reserved.