Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P08508
Gene Names Fcgr3
Alternative Names Fc-gamma RIII Short name: FcRIII CD_antigen: CD16
Expression Region Extracellular Domain(31-215aa )
Molecular Weight 37.2 kDa
Protein Sequence ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.
Involvement in Disease
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families
Tissue Specificity Fcgr3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE2MO357537

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III(Fcgr3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.