Recombinant Mouse Lithostathine-1(Reg1)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P43137
Gene Names Reg1
Alternative Names Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1
Expression Region Full Length of Mature Protein(22-165aa )
Molecular Weight 32.2 kDa
Protein Sequence QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Involvement in Disease
Subcellular Location Secreted
Protein Families
Tissue Specificity Reg1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE9MO337454

Recombinant Mouse Lithostathine-1(Reg1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Lithostathine-1(Reg1)
Copyright © 2026-present Echo Bio. All rights reserved.