Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3(Lilrb3),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P97484
Gene Names Lilrb3
Alternative Names Cell-surface glycoprotein p91;Paired immunoglobulin-like receptor B ;PIR-B
Expression Region Cytoplasmic Domain(664-841aa )
Molecular Weight 21.6 kDa
Protein Sequence RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Involvement in Disease
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families
Tissue Specificity Lilrb3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY1MO13066

Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3(Lilrb3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3(Lilrb3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.