Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P07750 |
| Uniprot Entry Name | |
| Gene Names | Il4 |
| Alternative Names | Interleukin-4;B-cell IgG differentiation factor;B-cell growth factor 1;B-cell stimulatory factor 1;IGG1 induction factor;Lymphocyte stimulatory factor 1;IL-4;BSF-1 |
| Expression Region | Partial (23-140aa) |
| Molecular Weight | 13.4 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four αhelix structure. IL4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL4 is primarily expressed by Th2biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naïve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. |
| Function | Participates in at least several B-cell activation processes as well as of other cell types |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-4/IL-13 family |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |