Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P07750 |
| Uniprot Entry Name | |
| Gene Names | Il4 |
| Alternative Names | Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1 |
| Expression Region | Full Length of Mature Protein (21-140aa) |
| Molecular Weight | 14.6 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response. |
| Function | Participates in at least several B-cell activation processes as well as of other cell types |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-4/IL-13 family |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
