Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P16297 |
| Gene Names | Il2rb |
| Alternative Names | High affinity IL-2 receptor subunit betap70-75; CD122 |
| Expression Region | Partial(27-240aa ) |
| Molecular Weight | 27.1 kDa |
| Protein Sequence | AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. |
| Involvement in Disease | |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | Type I cytokine receptor family, Type 4 subfamily |
| Tissue Specificity | Il2rb |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |