Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Protein Tag | N-terminal 10xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | |
| Biological Activity | |
| Uniprot ID | P70380 |
| Gene Names | Il18 |
| Alternative Names | (IL-18)(Interferon gamma-inducing factor)(IFN-gamma-inducing factor)(Interleukin-1 gamma)(IL-1 gamma) |
| Expression Region | 36-192aa(N36H,M85A,K87G,E90R,V91A,L94K) |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1682 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1804℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 20.5 kDa |
| Protein Sequence | HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Background
| Research Areas | Immunology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |