Recombinant Mouse Interleukin-18(Il18)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P70380
Gene Names Il18
Alternative Names Interferon gamma-inducing factor
Expression Region Full Length(1-192aa )
Molecular Weight 24.6 kDa
Protein Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Involvement in Disease
Subcellular Location Secreted
Protein Families IL-1 family
Tissue Specificity Il18
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PYOb0116205

Recombinant Mouse Interleukin-18(Il18)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Interleukin-18(Il18)
Copyright © 2026-present Echo Bio. All rights reserved.