Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q62386 |
| Uniprot Entry Name | |
| Gene Names | Il17a |
| Alternative Names | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 |
| Expression Region | Partial (22-158aa) |
| Molecular Weight | 16.2 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Mature mouse IL-17A shares 61% and 89% amino acid sequence identity with human and rat IL-17A, respectively. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation. |
| Function | Ligand for IL17RA |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | IL-17 family |
| Tissue Specificity | Restricted to a subset of activated T-cells. |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |