Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial (Active)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal Fc-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Uniprot ID Q60819
Uniprot Entry Name
Gene Names Il15ra
Alternative Names Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha
Expression Region Partial (33-205aa)
Molecular Weight 45.5 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons.
Function High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity).
Involvement in disease
Subcellular Location Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space
Protein Families
Tissue Specificity Widely expressed.
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$86.00
In stock
SKU
EB-CAPMO4926

Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.