Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 95% as determined by SDS-PAGE. |
Uniprot ID | P20109 |
Uniprot Entry Name | |
Gene Names | Il13 |
Alternative Names | Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13 |
Expression Region | Partial (26-131aa) |
Molecular Weight | 11.7 kDa |
Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
Sequence | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4) |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
Relevance | Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4Rα, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease. |
Function | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages |
Involvement in disease | |
Subcellular Location | Secreted |
Protein Families | IL-4/IL-13 family |
Tissue Specificity | |
Pathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |