Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Protein Tag | C-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P0DOV2 |
| Gene Names | Ifi204 |
| Alternative Names | (Ifi-204)(Interferon-inducible protein p204) |
| Expression Region | 216-417aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.843 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-957℃. |
| Protein Length | Partial |
| Molecular Weight | 24.2 kDa |
| Protein Sequence | QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN |
Background
| Research Areas | Others |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |