Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q3U4N7 |
| Gene Names | Igflr1 |
| Alternative Names | (Transmembrane protein 149) |
| Expression Region | 21-163aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.73 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-165℃. |
| Protein Length | Partial |
| Molecular Weight | 19.3 kDa |
| Protein Sequence | ASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSAS |
Background
| Research Areas | Cell Biology |
| Relevance | Probable cell membrane receptor for the IGF-like family protein IGFL. |
| Function | |
| Reference | "Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1." Lobito A.A., Ramani S.R., Tom I., Bazan J.F., Luis E., Fairbrother W.J., Ouyang W., Gonzalez L.C. J. Biol. Chem. 286:18969-18981(2011) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |