Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q8BIH0
Gene Names Sap130
Alternative Names 130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130
Expression Region Partial(845-1057aa )
Molecular Weight 26.8 kDa
Protein Sequence PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes
Involvement in Disease
Subcellular Location Nucleus
Protein Families SAP130 family
Tissue Specificity Sap130
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$331.00
In stock
SKU
EB-PY9MO807484

Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial
Copyright © 2026-present Echo Bio. All rights reserved.