Specification
    
        | Organism | Mus musculus (Mouse) | 
| Expression Host | in vitro E.coli expression system | 
| Tag Info | N-terminal 10xHis-SUMO-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P20489 | 
| Gene Names | Fcer1a | 
| Alternative Names | Fc-epsilon RI-alpha | 
| Expression Region | Full Length of Mature Protein(24-250aa ) | 
| Molecular Weight | 44.7 kDa | 
| Protein Sequence | ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. | 
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein | 
| Protein Families | |
| Tissue Specificity | Fcer1a | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
