Recombinant Mouse Hemoglobin subunit alpha(Hba)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P01942
Gene Names Hba
Alternative Names Alpha-globinHemoglobin alpha chain
Expression Region Full Length of Mature Protein(2-142aa )
Molecular Weight 17 kDa
Protein Sequence VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in oxygen transport from the lung to the various peripheral tissues.
Involvement in Disease
Subcellular Location
Protein Families Globin family
Tissue Specificity Hba
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY7MO10272

Recombinant Mouse Hemoglobin subunit alpha(Hba)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Hemoglobin subunit alpha(Hba)
Copyright © 2026-present Echo Bio. All rights reserved.