Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs

Specification
Gene Names Gpbar1
Alternative Names Membrane-type receptor for bile acids;M-BAR
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Molecular Weight 37.0 kDa
Expression Region Full Length(1-329aa )
Expression Region C-terminal 10xHis-tagged(Full Length )
Purity The purity information is not available for VLPs proteins.
Endotoxin
Form Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$693.00
In stock
SKU
EB-M0MO2321670

Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs
Copyright © 2021-present Echo Biosystems. All rights reserved.