Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P15655 |
| Uniprot Entry Name | |
| Gene Names | Fgf2 |
| Alternative Names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2 |
| Expression Region | Full Length (1-154aa) |
| Molecular Weight | 17.15 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 400 mM NaCl, pH 7.0) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions. |
| Function | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. |
| Involvement in disease | |
| Subcellular Location | Secreted, Nucleus |
| Protein Families | Heparin-binding growth factors family |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |