Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P61148 |
Gene Names | Fgf1 |
Alternative Names | Acidic fibroblast growth factor ;aFGFHeparin-binding growth factor 1 ;HBGF-1 |
Expression Region | Full Length of Mature Protein(16-155aa ) |
Molecular Weight | 19.8 kDa |
Protein Sequence | FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro . |
Involvement in Disease | |
Subcellular Location | Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus |
Protein Families | Heparin-binding growth factors family |
Tissue Specificity | Fgf1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |