Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q5SUS0 |
| Gene Names | Fbxw10 |
| Alternative Names | F-box and WD-40 domain-containing protein 10 |
| Expression Region | Partial(701-1030aa ) |
| Molecular Weight | 53.2 kDa |
| Protein Sequence | VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Fbxw10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |