Recombinant Mouse Excitatory amino acid transporter 2(Slc1a2),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P43006
Gene Names Slc1a2
Alternative Names GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2
Expression Region Partial(143-238aa )
Molecular Weight 37.6 kDa
Protein Sequence HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A2 subfamily
Tissue Specificity Slc1a2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY3MO21558

Recombinant Mouse Excitatory amino acid transporter 2(Slc1a2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Excitatory amino acid transporter 2(Slc1a2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.