Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P43006 |
| Gene Names | Slc1a2 |
| Alternative Names | GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2 |
| Expression Region | Partial(143-238aa ) |
| Molecular Weight | 37.6 kDa |
| Protein Sequence | HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A2 subfamily |
| Tissue Specificity | Slc1a2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
