Recombinant Mouse Epithelial cell adhesion molecule(Epcam),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q99JW5
Gene Names Epcam
Alternative Names Epithelial cell adhesion molecule(Ep-CAM)(Epithelial glycoprotein 314)(EGP314)(mEGP314)(Protein 289A)(Tumor-associated calcium signal transducer 1)(CD antigen CD326)
Expression Region Partial(24-266aa )
Molecular Weight 29.5 kDa
Protein Sequence QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E (By similarity).
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Epcam
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMOf177296

Recombinant Mouse Epithelial cell adhesion molecule(Epcam),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Epithelial cell adhesion molecule(Epcam),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.