Specification
Organism | Mus musculus (Mouse) |
Expression Host | Mammalian cell |
Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q99JW5 |
Gene Names | Epcam |
Alternative Names | Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326 |
Expression Region | Partial(24-266aa ) |
Molecular Weight | 32.7 |
Protein Sequence | QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E (By similarity). |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | Epcam |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |