Recombinant Mouse Epididymal-specific lipocalin-5(Lcn5)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A2AJB7
Gene Names Lcn5
Alternative Names Epididymal retinoic acid-binding protein Short name: E-RABP Short name: mE-RABP Epididymal secretory protein 10 Short name: MEP 10 Cleaved into the following 2 chains: Epididymal-specific lipocalin-5, major form Epididymal-specific lipocalin-5, minor form
Expression Region Full Length of Mature Protein(27-192aa )
Molecular Weight 22.3 kDa
Protein Sequence TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.
Involvement in Disease
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity Lcn5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE8MO381913

Recombinant Mouse Epididymal-specific lipocalin-5(Lcn5)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Epididymal-specific lipocalin-5(Lcn5)
Copyright © 2021-present Echo Biosystems. All rights reserved.