Specification
| Organism | Mus musculus(Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8BH95 |
| Gene Names | Echs1 |
| Alternative Names | Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH) |
| Expression Region | Full Length of Mature Protein(28-290aa ) |
| Molecular Weight | 33.5 kDa |
| Protein Sequence | ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Echs1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
