Recombinant Mouse Endothelin-converting enzyme-like 1(Ecel1),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9JMI0
Gene Names Ecel1
Alternative Names Damage-induced neuronal endopeptidase Xce protein Dine, Xce
Expression Region Partial(1-61aa )
Molecular Weight 13.7 kDa
Protein Sequence MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.
Involvement in Disease
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Peptidase M13 family
Tissue Specificity Ecel1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE7MO878242

Recombinant Mouse Endothelin-converting enzyme-like 1(Ecel1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Endothelin-converting enzyme-like 1(Ecel1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.