Recombinant Mouse D-dopachrome decarboxylase(Ddt)

Specification
Organism Mus musculus (Mouse)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O35215
Gene Names Ddt
Alternative Names D-dopachrome tautomerase
Expression Region Full Length of Mature Protein(2-118aa )
Molecular Weight 14.9 kDa
Protein Sequence PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families MIF family
Tissue Specificity Ddt
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY8MO6723

Recombinant Mouse D-dopachrome decarboxylase(Ddt)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse D-dopachrome decarboxylase(Ddt)
Copyright © 2021-present Echo Biosystems. All rights reserved.