Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Protein Tag | N-terminal 6xHis-KSI-tagged |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin Level | |
Biological Activity | |
Uniprot ID | Q8CIT0 |
Gene Names | Crh |
Alternative Names | (Corticotropin-releasing factor)(CRF)(Corticotropin-releasing hormone) |
Expression Region | 145-185aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1616 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1738℃. |
Protein Length | Full Length of Mature Protein |
Molecular Weight | 20.1 kDa |
Protein Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |