Recombinant Mouse Complement receptor type 2(Cr2),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P19070
Gene Names Cr2
Alternative Names Complement C3d receptor CD_antigen: CD21
Expression Region Partial(12-140aa )
Molecular Weight 18.1 kDa
Protein Sequence ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for complement C3d. Participates in B lymphocytes activation.
Involvement in Disease
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Receptors of complement activation (RCA) family
Tissue Specificity Cr2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEMO159466

Recombinant Mouse Complement receptor type 2(Cr2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Complement receptor type 2(Cr2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.