Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

Specification
Organism Mus musculus (Mouse)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9ES30
Gene Names C1qtnf3
Alternative Names Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Expression Region Full Length of Mature Protein(23-246aa )
Molecular Weight 26.6 kDa
Protein Sequence QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Secreted
Protein Families
Tissue Specificity C1qtnf3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$387.00
In stock
SKU
EB-PB0MO875485

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)
Copyright © 2021-present Echo Biosystems. All rights reserved.