Recombinant Mouse Collagen triple helix repeat-containing protein 1(Cthrc1)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Protein Tag C-terminal 10xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID Q9D1D6
Gene Names Cthrc1
Alternative Names
Expression Region 33-245aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1277 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1396℃.
Protein Length Full Length
Molecular Weight 25.9 kDa
Protein Sequence SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Background
Research Areas Cancer
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$644.00
In stock
SKU
EB-N232317

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Collagen triple helix repeat-containing protein 1(Cthrc1)
Copyright © 2021-present Echo Biosystems. All rights reserved.