Recombinant Mouse Chitinase domain-containing protein 1(Chid1)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info N-terminal 6xHis-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q922Q9
Gene Names Chid1
Alternative Names Chid1Chitinase domain-containing protein 1
Expression Region Full Length of Mature Protein(20-393aa )
Molecular Weight 46.9
Protein Sequence TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Chid1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$531.00
In stock
SKU
EB-PM5MO835770

Recombinant Mouse Chitinase domain-containing protein 1(Chid1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Chitinase domain-containing protein 1(Chid1)
Copyright © 2021-present Echo Biosystems. All rights reserved.