Recombinant Mouse Cerebellin-3(Cbln3)

Specification
Organism Mus musculus (Mouse)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9JHG0
Gene Names Cbln3
Alternative Names Cbln3Cerebellin-3
Expression Region Full Length of Mature Protein(25-197aa )
Molecular Weight 22.4 kDa
Protein Sequence QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May be involved in synaptic functions in the CNS.
Involvement in Disease
Subcellular Location Endoplasmic reticulum, Golgi apparatus, cis-Golgi network, Secreted, Cell junction, synapse
Protein Families
Tissue Specificity Cbln3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$754.00
In stock
SKU
EB-PC1MO881416

Recombinant Mouse Cerebellin-3(Cbln3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Cerebellin-3(Cbln3)
Copyright © 2021-present Echo Biosystems. All rights reserved.